ORCTL-2/SLC22A18 anticorps (N-Term)

N° du produit ABIN635226

Cet anticorps anti-ORCTL-2/SLC22A18 est un anticorps Lapin Polyclonal détectant ORCTL-2/SLC22A18 dans WB. Adapté pour Humain.

Aperçu rapide pour ORCTL-2/SLC22A18 anticorps (N-Term) (ABIN635226)

Antigène: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ORCTL-2/SLC22A18 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ORCTL-2/SLC22A18 anticorps

Épitope: N-Term

Specificité: SLC22 A18 antibody was raised against the N terminal of SLC22 18

Purification: Affinity purified

Immunogène: SLC22 A18 antibody was raised using the N terminal of SLC22 18 corresponding to a region with amino acids AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A18 Blocking Peptide, (ABIN936436), is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ORCTL-2/SLC22A18

Antigène: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Autre désignation: SLC22A18

Sujet: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.

Poids moléculaire: 45 kDa (MW of target protein)