Vip anticorps (Middle Region)

N° du produit ABIN635234

L’anticorps Lapin Polyclonal anti-Vip a été validé pour WB. Il convient pour détecter Vip dans des échantillons de Humain.

Aperçu rapide pour Vip anticorps (Middle Region) (ABIN635234)

Antigène: Vip (Vasoactive Intestinal Peptide (Vip))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Vip est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Vip anticorps

Épitope: Middle Region

Specificité: VIP antibody was raised against the middle region of VIP

Purification: Affinity purified

Immunogène: VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VIP Blocking Peptide, (ABIN5616967), is also available for use as a blocking control in assays to test for specificity of this VIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Vip

Antigène: Vip (Vasoactive Intestinal Peptide (Vip))

Autre désignation: VIP

Sujet: The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Poids moléculaire: 3 kDa (MW of target protein)

Pathways: Hormone Activity, cAMP Metabolic Process