RNF139 anticorps (N-Term)

N° du produit ABIN635236

Détail du produit anti-RNF139 anticorps

Antigène: RNF139 (Ring Finger Protein 139 (RNF139))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF139 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF139 antibody was raised against the N terminal of RNF139

Purification: Affinity purified

Immunogène: RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF139 Blocking Peptide, catalog no. 33R-8723, is also available for use as a blocking control in assays to test for specificity of this RNF139 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF139 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF139

Antigène: RNF139 (Ring Finger Protein 139 (RNF139))

Autre désignation: RNF139 (RNF139 Produits)

Synonymes: anticorps HRCA1, anticorps RCA1, anticorps TRC8, anticorps 4930555P18Rik, anticorps zgc:175173, anticorps rnf139, anticorps ring finger protein 139, anticorps ring finger protein 139 S homeolog, anticorps RNF139, anticorps Rnf139, anticorps rnf139, anticorps rnf139.S

Sujet: RNF139 is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP.

Poids moléculaire: 76 kDa (MW of target protein)