MUL1 anticorps (Middle Region)

N° du produit ABIN635254

Cet anticorps Lapin Polyclonal détecte spécifiquement MUL1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour MUL1 anticorps (Middle Region) (ABIN635254)

Antigène: MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MUL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MUL1 anticorps

Épitope: Middle Region

Specificité: C1 ORF166 antibody was raised against the middle region of C1 rf166

Purification: Affinity purified

Immunogène: C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF166 Blocking Peptide, (ABIN939975), is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MUL1

Antigène: MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))

Autre désignation: C1ORF166

Sujet: C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity