Dystroglycan anticorps

N° du produit ABIN635261

Détail du produit anti-Dystroglycan anticorps

Antigène: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Dystroglycan est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAG1 Blocking Peptide, catalog no. 33R-1265, is also available for use as a blocking control in assays to test for specificity of this DAG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Dystroglycan

Antigène: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Autre désignation: DAG1 (DAG1 Produits)

Synonymes: anticorps LOC398500, anticorps dag1, anticorps MGC53537, anticorps 156DAG, anticorps A3a, anticorps AGRNR, anticorps DAG, anticorps MDDGC7, anticorps MDDGC9, anticorps DAG1, anticorps RAB7, anticorps dg, anticorps a3a, anticorps dag, anticorps agrnr, anticorps 156dag, anticorps D9Wsu13e, anticorps DG, anticorps Dp427, anticorps Dp71, anticorps CG18250, anticorps CT41273, anticorps DmDG, anticorps Dmel\\CG18250, anticorps atu, anticorps dgn, anticorps dys, anticorps GB14967, anticorps APOJ, anticorps CLI, anticorps RATTRPM2B, anticorps SGP-2, anticorps SGP2, anticorps SP-40, anticorps SP40, anticorps TRPM-2, anticorps TRPM2B, anticorps Trpm2, anticorps Trpmb, anticorps Ala-1, anticorps H9/25, anticorps Ly-27, anticorps Ly-6, anticorps Ly27, anticorps wu:fb83d06, anticorps wu:fi25f06, anticorps wu:fi37b08, anticorps zgc:109786, anticorps DystroGlycaN, anticorps dystroglycan 1 L homeolog, anticorps dystroglycan 1, anticorps dystroglycan 1 S homeolog, anticorps Dystroglycan, anticorps dystroglycan, anticorps clusterin, anticorps lymphocyte antigen 6 complex, anticorps dgn-1, anticorps dag1.L, anticorps dgn-2, anticorps dgn-3, anticorps DAG1, anticorps dag1.S, anticorps Dag1, anticorps dag1, anticorps Dg, anticorps LOC408826, anticorps Clu, anticorps Ly6

Sujet: Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus