Dystroglycan anticorps

N° du produit ABIN635261

L’anticorps anti-Dystroglycan Polyclonal Lapin est utilisé pour la détection de Dystroglycan dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour Dystroglycan anticorps (ABIN635261)

Antigène: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Dystroglycan est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Dystroglycan anticorps

Purification: Affinity purified

Immunogène: DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAG1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DAG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Dystroglycan

Antigène: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Autre désignation: DAG1

Sujet: Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus