SLC45A2 anticorps (C-Term)

N° du produit ABIN635265

Cet anticorps anti-SLC45A2 est un anticorps Lapin Polyclonal détectant SLC45A2 dans WB. Adapté pour Humain.

Aperçu rapide pour SLC45A2 anticorps (C-Term) (ABIN635265)

Antigène: SLC45A2 (Solute Carrier Family 45, Member 2 (SLC45A2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC45A2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC45A2 anticorps

Épitope: C-Term

Specificité: SLC45 A2 antibody was raised against the C terminal of SLC45 2

Purification: Affinity purified

Immunogène: SLC45 A2 antibody was raised using the C terminal of SLC45 2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC45A2 Blocking Peptide, (ABIN939366), is also available for use as a blocking control in assays to test for specificity of this SLC45A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC45A2

Antigène: SLC45A2 (Solute Carrier Family 45, Member 2 (SLC45A2))

Autre désignation: SLC45A2

Sujet: SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.

Poids moléculaire: 51 kDa (MW of target protein)