FAR2 anticorps (C-Term)

N° du produit ABIN635311

Cet anticorps Lapin Polyclonal détecte spécifiquement FAR2 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour FAR2 anticorps (C-Term) (ABIN635311)

Antigène: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAR2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAR2 anticorps

Épitope: C-Term

Specificité: MLSTD1 antibody was raised against the C terminal Of Mlstd1

Purification: Affinity purified

Immunogène: MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MLSTD1 Blocking Peptide, (ABIN935972), is also available for use as a blocking control in assays to test for specificity of this MLSTD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAR2

Antigène: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Autre désignation: MLSTD1

Sujet: MLSTD1 catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome