FAR2 anticorps (C-Term)

N° du produit ABIN635311

Détail du produit anti-FAR2 anticorps

Antigène: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MLSTD1 antibody was raised against the C terminal Of Mlstd1

Purification: Affinity purified

Immunogène: MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MLSTD1 Blocking Peptide, catalog no. 33R-10019, is also available for use as a blocking control in assays to test for specificity of this MLSTD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAR2

Antigène: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Autre désignation: MLSTD1 (FAR2 Produits)

Synonymes: anticorps MLSTD1, anticorps SDR10E2, anticorps A230046P18, anticorps AW048109, anticorps BC055759, anticorps Mlstd1, anticorps RGD1565966, anticorps FAR2, anticorps FATTY ACID REDUCTASE 2, anticorps MALE STERILITY 2, anticorps MALE STERILITY PROTEIN 2, anticorps MEC18.1, anticorps fatty acyl-CoA reductase 2, anticorps fatty acyl CoA reductase 2, anticorps Jojoba acyl CoA reductase-related male sterility protein, anticorps FAR2, anticorps Far2, anticorps MS2

Sujet: MLSTD1 catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome