SECTM1 anticorps (Middle Region)

N° du produit ABIN635331

Cet anticorps anti-SECTM1 Polyclonal Lapin (ABIN635331) détecte spécifiquement SECTM1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SECTM1 anticorps (Middle Region) (ABIN635331)

Antigène: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SECTM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SECTM1 anticorps

Épitope: Middle Region

Specificité: SECTM1 antibody was raised against the middle region of SECTM1

Purification: Affinity purified

Immunogène: SECTM1 antibody was raised using the middle region of SECTM1 corresponding to a region with amino acids ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SECTM1 Blocking Peptide, (ABIN936853), is also available for use as a blocking control in assays to test for specificity of this SECTM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SECTM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SECTM1

Antigène: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Autre désignation: SECTM1

Sujet: This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Poids moléculaire: 27 kDa (MW of target protein)