Podoplanin anticorps (N-Term)

N° du produit ABIN635389

Cet anticorps Lapin Polyclonal détecte spécifiquement Podoplanin dans WB et IHC. Il présente une réactivité envers Humain.

Aperçu rapide pour Podoplanin anticorps (N-Term) (ABIN635389)

Antigène: Podoplanin (PDPN)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Podoplanin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Podoplanin anticorps

Épitope: N-Term

Specificité: Podoplanin antibody was raised against the N terminal of PDPN

Purification: Affinity purified

Immunogène: Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Podoplanin Blocking Peptide, (ABIN937806), is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Podoplanin

Antigène: Podoplanin (PDPN)

Autre désignation: Podoplanin

Sujet: PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport