PLD3 anticorps (N-Term)

N° du produit ABIN635404

Détail du produit anti-PLD3 anticorps

Antigène: PLD3 (Phospholipase D family member 3 (PLD3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLD3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLD3 antibody was raised against the N terminal of PLD3

Purification: Affinity purified

Immunogène: PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLD3 Blocking Peptide, catalog no. 33R-10033, is also available for use as a blocking control in assays to test for specificity of this PLD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLD3

Antigène: PLD3 (Phospholipase D family member 3 (PLD3))

Autre désignation: PLD3 (PLD3 Produits)

Synonymes: anticorps DDBDRAFT_0204850, anticorps DDBDRAFT_0231505, anticorps DDB_0204850, anticorps DDB_0231505, anticorps DDBDRAFT_0187542, anticorps DDBDRAFT_0220113, anticorps DDB_0187542, anticorps DDB_0220113, anticorps HU-K4, anticorps HUK4, anticorps Sam-9, anticorps phospholipase D3, anticorps phospholipase D family member 3, anticorps phospholipase D family, member 3, anticorps CpipJ_CPIJ017227, anticorps pldZ, anticorps pldY, anticorps DICPUDRAFT_30308, anticorps PLD3, anticorps Pld3

Sujet: PLD3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome