LARGE anticorps (Middle Region)

N° du produit ABIN635429

Détail du produit anti-LARGE anticorps

Antigène: LARGE (Like-Glycosyltransferase (LARGE))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LARGE est non-conjugé

Application: Western Blotting (WB)

Specificité: LARGE antibody was raised against the middle region of LARGE

Purification: Affinity purified

Immunogène: LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LARGE Blocking Peptide, catalog no. 33R-1247, is also available for use as a blocking control in assays to test for specificity of this LARGE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARGE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LARGE

Antigène: LARGE (Like-Glycosyltransferase (LARGE))

Autre désignation: LARGE (LARGE Produits)

Synonymes: anticorps gyltl1b, anticorps gyltl1b-b, anticorps mdc1d, anticorps MDC1D, anticorps MDDGA6, anticorps MDDGB6, anticorps BPFD36, anticorps Gyltl1a, anticorps Mbp-1, anticorps Mbp1, anticorps enr, anticorps fg, anticorps froggy, anticorps mKIAA0609, anticorps myd, anticorps NV15834, anticorps DKFZp459G0120, anticorps LARGE xylosyl- and glucuronyltransferase 1 L homeolog, anticorps LARGE xylosyl- and glucuronyltransferase 1, anticorps glycosyltransferase-like protein LARGE1, anticorps like-glycosyltransferase, anticorps large1.L, anticorps LARGE1, anticorps Large1, anticorps large1, anticorps LOC100118066, anticorps LARGE, anticorps Large

Sujet: This gene, which is one of the largest in the human genome, encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan.

Poids moléculaire: 88 kDa (MW of target protein)