RER1 anticorps

N° du produit ABIN635434

Cet anticorps Lapin Polyclonal détecte spécifiquement RER1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour RER1 anticorps (ABIN635434)

Antigène: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RER1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RER1 anticorps

Purification: Affinity purified

Immunogène: RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RER1 Blocking Peptide, (ABIN938735), is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RER1

Antigène: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Autre désignation: RER1

Sujet: RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

Poids moléculaire: 23 kDa (MW of target protein)