SEC63 anticorps

N° du produit ABIN635435

Détail du produit anti-SEC63 anticorps

Antigène: SEC63 (SEC63 Homolog (SEC63))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEC63 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEC63 Blocking Peptide, catalog no. 33R-9989, is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEC63

Antigène: SEC63 (SEC63 Homolog (SEC63))

Autre désignation: SEC63 (SEC63 Produits)

Synonymes: anticorps DNAJC23, anticorps ERdj2, anticorps PRO2507, anticorps SEC63L, anticorps 5730478J10Rik, anticorps AI649014, anticorps AW319215, anticorps SEC63-like, anticorps zgc:92718, anticorps SEC63 homolog, protein translocation regulator, anticorps SEC63-like (S. cerevisiae), anticorps SEC63 homolog, protein translocation regulator L homeolog, anticorps SEC63, anticorps Sec63, anticorps sec63, anticorps sec63.L

Sujet: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex.

Poids moléculaire: 88 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling