Junctophilin 1 anticorps (C-Term)

N° du produit ABIN635471

L’anticorps anti-Junctophilin 1 Polyclonal Lapin est utilisé pour la détection de Junctophilin 1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour Junctophilin 1 anticorps (C-Term) (ABIN635471)

Antigène: Junctophilin 1 (JPH1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Junctophilin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Junctophilin 1 anticorps

Épitope: C-Term

Specificité: Junctophilin 1 antibody was raised against the C terminal of JPH1

Purification: Affinity purified

Immunogène: Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Junctophilin 1 Blocking Peptide, (ABIN5614247), is also available for use as a blocking control in assays to test for specificity of this Junctophilin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Junctophilin 1

Antigène: Junctophilin 1 (JPH1)

Autre désignation: Junctophilin 1

Sujet: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH1 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.

Poids moléculaire: 72 kDa (MW of target protein)