Junctophilin 1 anticorps (C-Term)

N° du produit ABIN635471

Détail du produit anti-Junctophilin 1 anticorps

Antigène: Junctophilin 1 (JPH1)

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Junctophilin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Junctophilin 1 antibody was raised against the C terminal of JPH1

Purification: Affinity purified

Immunogène: Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Junctophilin 1 Blocking Peptide, catalog no. 33R-8651, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Junctophilin 1

Antigène: Junctophilin 1 (JPH1)

Autre désignation: Junctophilin 1 (JPH1 Produits)

Synonymes: anticorps JP-1, anticorps JP1, anticorps ENSMUSG00000054314, anticorps Jp1, anticorps bZ1M12.3, anticorps jph1, anticorps si:rp71-1m12.3, anticorps Jph1, anticorps junctophilin 1, anticorps junctophilin 1a, anticorps junctophilin-1, anticorps JPH1, anticorps Jph1, anticorps jph1, anticorps jph1a, anticorps LOC100547979

Sujet: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH1 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.

Poids moléculaire: 72 kDa (MW of target protein)