ABHD13 anticorps (N-Term)

N° du produit ABIN635522

L’anticorps Lapin Polyclonal anti-ABHD13 a été validé pour WB. Il convient pour détecter ABHD13 dans des échantillons de Humain.

Aperçu rapide pour ABHD13 anticorps (N-Term) (ABIN635522)

Antigène: ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABHD13 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABHD13 anticorps

Épitope: N-Term

Specificité: ABHD13 antibody was raised against the N terminal of ABHD13

Purification: Affinity purified

Immunogène: ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABHD13 Blocking Peptide, (ABIN5611863), is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABHD13

Antigène: ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))

Autre désignation: ABHD13

Sujet: ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.

Poids moléculaire: 38 kDa (MW of target protein)