ORCTL-2/SLC22A18 anticorps (Middle Region)

N° du produit ABIN635531

L’anticorps anti-ORCTL-2/SLC22A18 Polyclonal Lapin est utilisé pour la détection de ORCTL-2/SLC22A18 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour ORCTL-2/SLC22A18 anticorps (Middle Region) (ABIN635531)

Antigène: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ORCTL-2/SLC22A18 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ORCTL-2/SLC22A18 anticorps

Épitope: Middle Region

Specificité: SLC22 A18 antibody was raised against the middle region of SLC22 18

Purification: Affinity purified

Immunogène: SLC22 A18 antibody was raised using the middle region of SLC22 18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A18 Blocking Peptide, (ABIN939496), is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ORCTL-2/SLC22A18

Antigène: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Autre désignation: SLC22A18

Sujet: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.

Poids moléculaire: 45 kDa (MW of target protein)