UST anticorps (N-Term)

N° du produit ABIN635536

Cet anticorps Lapin Polyclonal détecte spécifiquement UST dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour UST anticorps (N-Term) (ABIN635536)

Antigène: UST (Uronyl-2-Sulfotransferase (UST))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UST est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UST anticorps

Épitope: N-Term

Specificité: UST antibody was raised against the N terminal of UST

Purification: Affinity purified

Immunogène: UST antibody was raised using the N terminal of UST corresponding to a region with amino acids PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UST Blocking Peptide, (ABIN5616940), is also available for use as a blocking control in assays to test for specificity of this UST antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UST

Antigène: UST (Uronyl-2-Sulfotransferase (UST))

Autre désignation: UST

Sujet: UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process