UST anticorps (N-Term)
-
- Antigène Voir toutes UST Anticorps
- UST (Uronyl-2-Sulfotransferase (UST))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UST est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UST antibody was raised against the N terminal of UST
- Purification
- Affinity purified
- Immunogène
- UST antibody was raised using the N terminal of UST corresponding to a region with amino acids PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL
- Top Product
- Discover our top product UST Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UST Blocking Peptide, catalog no. 33R-7275, is also available for use as a blocking control in assays to test for specificity of this UST antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UST antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UST (Uronyl-2-Sulfotransferase (UST))
- Autre désignation
- UST (UST Produits)
- Synonymes
- anticorps si:dkey-185l3.2, anticorps 2OST, anticorps D930010O20Rik, anticorps UA2OST, anticorps uronyl 2-sulfotransferase, anticorps uronyl-2-sulfotransferase, anticorps UST, anticorps ust, anticorps Ust
- Sujet
- UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-