ABCC1 anticorps

N° du produit ABIN635554

Cet anticorps Lapin Polyclonal détecte spécifiquement ABCC1 dans WB. Il présente une réactivité avec des échantillons de Humain et Chien.

Aperçu rapide pour ABCC1 anticorps (ABIN635554)

Antigène: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABCC1 anticorps

Purification: Affinity purified

Immunogène: ABCC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCC1 Blocking Peptide, (ABIN940327), is also available for use as a blocking control in assays to test for specificity of this ABCC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCC1

Antigène: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Autre désignation: ABCC1

Sujet: ABCC1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates.

Poids moléculaire: 171 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome