CRTAP anticorps (N-Term)

N° du produit ABIN635556

Cet anticorps anti-CRTAP est un anticorps Lapin Polyclonal détectant CRTAP dans WB. Adapté pour Humain.

Aperçu rapide pour CRTAP anticorps (N-Term) (ABIN635556)

Antigène: CRTAP (Cartilage Associated Protein (CRTAP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRTAP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CRTAP anticorps

Épitope: N-Term

Specificité: CRTAP antibody was raised against the N terminal of CRTAP

Purification: Affinity purified

Immunogène: CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRTAP Blocking Peptide, (ABIN5613008), is also available for use as a blocking control in assays to test for specificity of this CRTAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRTAP

Antigène: CRTAP (Cartilage Associated Protein (CRTAP))

Autre désignation: CRTAP

Sujet: The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli.

Poids moléculaire: 44 kDa (MW of target protein)