SLC26A4 anticorps (Middle Region)

N° du produit ABIN635614

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC26A4 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour SLC26A4 anticorps (Middle Region) (ABIN635614)

Antigène: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC26A4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC26A4 anticorps

Épitope: Middle Region

Specificité: SLC26 A4 antibody was raised against the middle region of SLC26 4

Purification: Affinity purified

Immunogène: SLC26 A4 antibody was raised using the middle region of SLC26 4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC26A4 Blocking Peptide, (ABIN937949), is also available for use as a blocking control in assays to test for specificity of this SLC26A4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC26A4

Antigène: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Autre désignation: SLC26A4

Sujet: Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene.

Poids moléculaire: 86 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Sensory Perception of Sound