Klotho beta anticorps (Middle Region)

N° du produit ABIN635626

Cet anticorps Lapin Polyclonal détecte spécifiquement Klotho beta dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Klotho beta anticorps (Middle Region) (ABIN635626)

Antigène: Klotho beta (KLB)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Klotho beta est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Klotho beta anticorps

Épitope: Middle Region

Specificité: Klotho Beta antibody was raised against the middle region of KLB

Purification: Affinity purified

Immunogène: Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Klotho Beta Blocking Peptide, (ABIN937254), is also available for use as a blocking control in assays to test for specificity of this Klotho Beta antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Klotho beta

Antigène: Klotho beta (KLB)

Autre désignation: Klotho beta

Sujet: KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.

Poids moléculaire: 120 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Growth Factor Binding