Surfactant Protein C anticorps (N-Term)

N° du produit ABIN635635

Détail du produit anti-Surfactant Protein C anticorps

Antigène: Surfactant Protein C (SFTPC)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Surfactant Protein C est non-conjugé

Application: Western Blotting (WB)

Specificité: SFTPC antibody was raised against the N terminal of SFTPC

Purification: Affinity purified

Immunogène: SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFTPC Blocking Peptide, catalog no. 33R-5881, is also available for use as a blocking control in assays to test for specificity of this SFTPC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Surfactant Protein C

Antigène: Surfactant Protein C (SFTPC)

Autre désignation: SFTPC (SFTPC Produits)

Synonymes: anticorps SFTPC, anticorps SPC, anticorps SP-C, anticorps psp-c, anticorps sftp2, anticorps xSP-C, anticorps Bricd6, anticorps SP5, anticorps Sftp-2, anticorps Sftp2, anticorps pro-SpC, anticorps BRICD6, anticorps PSP-C, anticorps SFTP2, anticorps SMDP2, anticorps surfactant protein C, anticorps surfactant, pulmonary-associated protein C S homeolog, anticorps surfactant, pulmonary-associated protein C, anticorps surfactant associated protein C, anticorps SFTPC, anticorps sftpc.S, anticorps sftpc, anticorps Sftpc

Sujet: This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids.

Poids moléculaire: 21 kDa (MW of target protein)