SUSD3 anticorps (N-Term)

N° du produit ABIN635664

Détail du produit anti-SUSD3 anticorps

Antigène: SUSD3 (Sushi Domain Containing 3 (SUSD3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUSD3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SUSD3 antibody was raised against the N terminal of SUSD3

Purification: Affinity purified

Immunogène: SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SUSD3 Blocking Peptide, catalog no. 33R-5371, is also available for use as a blocking control in assays to test for specificity of this SUSD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUSD3

Antigène: SUSD3 (Sushi Domain Containing 3 (SUSD3))

Autre désignation: SUSD3 (SUSD3 Produits)

Synonymes: anticorps 1700017I11Rik, anticorps 2810440J20Rik, anticorps sushi domain containing 3, anticorps SUSD3, anticorps Susd3

Sujet: The function of SUSD3 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 27 kDa (MW of target protein)