Unc5c anticorps

N° du produit ABIN635708

L’anticorps anti-Unc5c Polyclonal Lapin est utilisé pour la détection de Unc5c dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour Unc5c anticorps (ABIN635708)

Antigène: Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Unc5c est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Unc5c anticorps

Purification: Affinity purified

Immunogène: UNC5 C antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC5C Blocking Peptide, (ABIN5616912), is also available for use as a blocking control in assays to test for specificity of this UNC5C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Unc5c

Antigène: Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))

Autre désignation: UNC5C

Sujet: UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

Poids moléculaire: 103 kDa (MW of target protein)