Unc5c anticorps
-
- Antigène Voir toutes Unc5c Anticorps
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Unc5c est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UNC5 C antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS
- Top Product
- Discover our top product Unc5c Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UNC5C Blocking Peptide, catalog no. 33R-9901, is also available for use as a blocking control in assays to test for specificity of this UNC5C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
- Autre désignation
- UNC5C (Unc5c Produits)
- Synonymes
- anticorps UNC5C, anticorps UNC5H3, anticorps 6030473H24, anticorps AI047720, anticorps B130051O18Rik, anticorps Unc5h3, anticorps rcm, anticorps wu:fb03d07, anticorps unc-5 netrin receptor C, anticorps UNC5C, anticorps Unc5c, anticorps unc5c
- Sujet
- UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
- Poids moléculaire
- 103 kDa (MW of target protein)
-