DNASE2B anticorps (N-Term)

N° du produit ABIN635735

L’anticorps Lapin Polyclonal anti-DNASE2B a été validé pour WB. Il convient pour détecter DNASE2B dans des échantillons de Humain.

Aperçu rapide pour DNASE2B anticorps (N-Term) (ABIN635735)

Antigène: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNASE2B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DNASE2B anticorps

Épitope: N-Term

Specificité: DNASE2 B antibody was raised against the N terminal of DNASE2

Purification: Affinity purified

Immunogène: DNASE2 B antibody was raised using the N terminal of DNASE2 corresponding to a region with amino acids EGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNASE2B Blocking Peptide, (ABIN937819), is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNASE2B

Antigène: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Autre désignation: DNASE2B

Sujet: DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II.

Poids moléculaire: 39 kDa (MW of target protein)