GALC anticorps (Middle Region)

N° du produit ABIN635737

Cet anticorps Lapin Polyclonal détecte spécifiquement GALC dans WB. Il présente une réactivité envers Humain, Rat, Souris et Chien.

Aperçu rapide pour GALC anticorps (Middle Region) (ABIN635737)

Antigène: GALC (Galactosylceramidase (GALC))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GALC anticorps

Épitope: Middle Region

Specificité: GALC antibody was raised against the middle region of GALC

Purification: Affinity purified

Immunogène: GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALC Blocking Peptide, (ABIN5613708), is also available for use as a blocking control in assays to test for specificity of this GALC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALC

Antigène: GALC (Galactosylceramidase (GALC))

Autre désignation: GALC

Sujet: GALC is a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy.

Poids moléculaire: 73 kDa (MW of target protein)