PAM anticorps (N-Term)

N° du produit ABIN635741

L’anticorps anti-PAM Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de PAM dans des échantillons provenant de Humain. }

Aperçu rapide pour PAM anticorps (N-Term) (ABIN635741)

Antigène: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAM est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PAM anticorps

Épitope: N-Term

Specificité: PAM antibody was raised against the N terminal of PAM

Purification: Affinity purified

Immunogène: PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAM Blocking Peptide, (ABIN5615206), is also available for use as a blocking control in assays to test for specificity of this PAM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAM

Antigène: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Autre désignation: PAM

Sujet: PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.

Poids moléculaire: 108 kDa (MW of target protein)