LIM2 anticorps (N-Term)

N° du produit ABIN635747

L’anticorps Lapin Polyclonal anti-LIM2 a été validé pour WB. Il convient pour détecter LIM2 dans des échantillons de Humain.

Aperçu rapide pour LIM2 anticorps (N-Term) (ABIN635747)

Antigène: LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIM2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LIM2 anticorps

Épitope: N-Term

Specificité: LIM2 antibody was raised against the N terminal of LIM2

Purification: Affinity purified

Immunogène: LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIM2 Blocking Peptide, (ABIN938945), is also available for use as a blocking control in assays to test for specificity of this LIM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIM2

Antigène: LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))

Autre désignation: LIM2

Sujet: This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization