GNS anticorps (C-Term)

N° du produit ABIN635775

Cet anticorps anti-GNS est un anticorps Lapin Polyclonal détectant GNS dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour GNS anticorps (C-Term) (ABIN635775)

Antigène: GNS (Glucosamine (N-Acetyl)-6-Sulfatase (GNS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GNS anticorps

Épitope: C-Term

Specificité: GNS antibody was raised against the C terminal of GNS

Purification: Affinity purified

Immunogène: GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNS Blocking Peptide, (ABIN5613817), is also available for use as a blocking control in assays to test for specificity of this GNS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNS

Antigène: GNS (Glucosamine (N-Acetyl)-6-Sulfatase (GNS))

Autre désignation: GNS

Sujet: GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process