GNS anticorps (C-Term)

N° du produit ABIN635775

Détail du produit anti-GNS anticorps

Antigène: GNS (Glucosamine (N-Acetyl)-6-Sulfatase (GNS))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNS est non-conjugé

Application: Western Blotting (WB)

Specificité: GNS antibody was raised against the C terminal of GNS

Purification: Affinity purified

Immunogène: GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNS Blocking Peptide, catalog no. 33R-7159, is also available for use as a blocking control in assays to test for specificity of this GNS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNS

Antigène: GNS (Glucosamine (N-Acetyl)-6-Sulfatase (GNS))

Autre désignation: GNS (GNS Produits)

Synonymes: anticorps G6S, anticorps 2610016K11Rik, anticorps AU042285, anticorps C87209, anticorps N28088, anticorps NV14559, anticorps N-acetylglucosamine-6-sulfatase, anticorps zgc:114066, anticorps gns, anticorps wu:fi20h10, anticorps zgc:55370, anticorps glucosamine (N-acetyl)-6-sulfatase, anticorps glucosamine (N-acetyl)-6-sulfatase S homeolog, anticorps glucosamine (N-acetyl)-6-sulfatase a, anticorps N-acetylglucosamine-6-sulfatase, anticorps glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID), b, anticorps GNS, anticorps Gns, anticorps gns.S, anticorps gns, anticorps gnsa, anticorps CpipJ_CPIJ000745, anticorps Sros_7372, anticorps VDBG_04409, anticorps Halhy_3165, anticorps gnsb

Sujet: GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process