ADAM19 anticorps

N° du produit ABIN635783

Détail du produit anti-ADAM19 anticorps

Antigène: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM19 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAM19 Blocking Peptide, catalog no. 33R-9408, is also available for use as a blocking control in assays to test for specificity of this ADAM19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAM19

Antigène: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Autre désignation: ADAM19 (Adam19 Produits)

Synonymes: anticorps AL024287, anticorps M[b], anticorps Mltnb, anticorps MADDAM, anticorps MLTNB, anticorps Sox30, anticorps fksg34, anticorps maddam, anticorps mltnb, anticorps a disintegrin and metallopeptidase domain 19 (meltrin beta), anticorps ADAM metallopeptidase domain 19, anticorps ADAM metallopeptidase domain 19 S homeolog, anticorps Adam19, anticorps ADAM19, anticorps adam19.S

Sujet: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.

Poids moléculaire: 82 kDa (MW of target protein)