ADAM7 anticorps (C-Term)

N° du produit ABIN635785

Détail du produit anti-ADAM7 anticorps

Antigène: ADAM7 (ADAM Metallopeptidase Domain 7 (ADAM7))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM7 est non-conjugé

Application: Western Blotting (WB)

Specificité: ADAM7 antibody was raised against the C terminal of ADAM7

Purification: Affinity purified

Immunogène: ADAM7 antibody was raised using the C terminal of ADAM7 corresponding to a region with amino acids PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAM7 Blocking Peptide, catalog no. 33R-7385, is also available for use as a blocking control in assays to test for specificity of this ADAM7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAM7

Antigène: ADAM7 (ADAM Metallopeptidase Domain 7 (ADAM7))

Autre désignation: ADAM7 (ADAM7 Produits)

Synonymes: anticorps ADAM7, anticorps 9230104J12Rik, anticorps EAP1, anticorps EAPI, anticorps ADAM 7, anticorps ADAM-7, anticorps GP-83, anticorps GP83, anticorps 7, anticorps ADAM, anticorps EAP, anticorps EAP I, anticorps I, anticorps ADAM metallopeptidase domain 7, anticorps a disintegrin and metallopeptidase domain 7, anticorps ADAM7, anticorps Adam7

Sujet: The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.

Poids moléculaire: 83 kDa (MW of target protein)

Pathways: Signalisation Notch