IGSF9 anticorps (N-Term)

N° du produit ABIN635786

Détail du produit anti-IGSF9 anticorps

Antigène: IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGSF9 est non-conjugé

Application: Western Blotting (WB)

Specificité: IGSF9 antibody was raised against the N terminal of IGSF9

Purification: Affinity purified

Immunogène: IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGSF9 Blocking Peptide, catalog no. 33R-8693, is also available for use as a blocking control in assays to test for specificity of this IGSF9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGSF9

Antigène: IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))

Autre désignation: IGSF9 (IGSF9 Produits)

Synonymes: anticorps FP18798, anticorps IGSF9A, anticorps Nrt1, anticorps 644ETD8, anticorps Dasm1, anticorps Kiaa1355-hp, anticorps NRT1, anticorps Ncaml, anticorps mKIAA1355, anticorps immunoglobulin superfamily member 9, anticorps immunoglobulin superfamily, member 9, anticorps IGSF9, anticorps igsf9, anticorps Igsf9

Sujet: IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.

Poids moléculaire: 125 kDa (MW of target protein)