BACE1 anticorps (N-Term)

N° du produit ABIN635849

L’anticorps Lapin Polyclonal anti-BACE1 a été validé pour WB. Il convient pour détecter BACE1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour BACE1 anticorps (N-Term) (ABIN635849)

Antigène: BACE1 (Beta-secretase 1 (BACE1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BACE1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BACE1 anticorps

Épitope: N-Term

Specificité: BACE1 antibody was raised against the N terminal of BACE1

Purification: Affinity purified

Immunogène: BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BACE1 Blocking Peptide, (ABIN938882), is also available for use as a blocking control in assays to test for specificity of this BACE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BACE1

Antigène: BACE1 (Beta-secretase 1 (BACE1))

Autre désignation: BACE1

Sujet: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Poids moléculaire: 51 kDa (MW of target protein)