SLITRK6 anticorps (N-Term)
-
- Antigène Voir toutes SLITRK6 Anticorps
- SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLITRK6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLITRK6 antibody was raised against the N terminal of SLITRK6
- Purification
- Affinity purified
- Immunogène
- SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL
- Top Product
- Discover our top product SLITRK6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLITRK6 Blocking Peptide, catalog no. 33R-6684, is also available for use as a blocking control in assays to test for specificity of this SLITRK6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))
- Autre désignation
- SLITRK6 (SLITRK6 Produits)
- Sujet
- Members of the SLITRK family, such as SLITRK6, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, including SLITRK6, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.
- Poids moléculaire
- 95 kDa (MW of target protein)
-