Neuropilin 1 anticorps (N-Term)

N° du produit ABIN635859

Cet anticorps anti-Neuropilin 1 est un anticorps Lapin Polyclonal détectant Neuropilin 1 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour Neuropilin 1 anticorps (N-Term) (ABIN635859)

Antigène: Neuropilin 1 (NRP1)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Neuropilin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Neuropilin 1 anticorps

Épitope: N-Term

Specificité: Neuropilin antibody was raised against the N terminal of NETO2

Purification: Affinity purified

Immunogène: Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Neuropilin Blocking Peptide, (ABIN938715), is also available for use as a blocking control in assays to test for specificity of this Neuropilin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NETO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Neuropilin 1

Antigène: Neuropilin 1 (NRP1)

Autre désignation: Neuropilin

Sujet: NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals