HHAT anticorps (N-Term)

N° du produit ABIN635877

Détail du produit anti-HHAT anticorps

Antigène: HHAT (Hedgehog Acyltransferase (HHAT))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HHAT est non-conjugé

Application: Western Blotting (WB)

Specificité: HHAT antibody was raised against the N terminal of HHAT

Purification: Affinity purified

Immunogène: HHAT antibody was raised using the N terminal of HHAT corresponding to a region with amino acids MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HHAT Blocking Peptide, catalog no. 33R-6202, is also available for use as a blocking control in assays to test for specificity of this HHAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HHAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HHAT

Antigène: HHAT (Hedgehog Acyltransferase (HHAT))

Autre désignation: HHAT (HHAT Produits)

Synonymes: anticorps RGD1311746, anticorps MART2, anticorps SKI1, anticorps Skn, anticorps 2810432O22Rik, anticorps AI462858, anticorps AP-2CRE, anticorps Tg(TFAP2A-cre)1Will, anticorps hedgehog acyltransferase, anticorps Hhat, anticorps HHAT, anticorps hhat

Sujet: Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog'.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Signalisation Hedgehog