ERLIN1 anticorps (N-Term)

N° du produit ABIN635966

L’anticorps Lapin Polyclonal anti-ERLIN1 a été validé pour WB. Il convient pour détecter ERLIN1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ERLIN1 anticorps (N-Term) (ABIN635966)

Antigène: ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERLIN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ERLIN1 anticorps

Épitope: N-Term

Specificité: ERLIN1 antibody was raised against the N terminal of ERLIN1

Purification: Affinity purified

Immunogène: ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERLIN1 Blocking Peptide, (ABIN939963), is also available for use as a blocking control in assays to test for specificity of this ERLIN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERLIN1

Antigène: ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))

Autre désignation: ERLIN1

Sujet: Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.

Poids moléculaire: 39 kDa (MW of target protein)