ERLIN1 anticorps (N-Term)
-
- Antigène Voir toutes ERLIN1 Anticorps
- ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERLIN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ERLIN1 antibody was raised against the N terminal of ERLIN1
- Purification
- Affinity purified
- Immunogène
- ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH
- Top Product
- Discover our top product ERLIN1 Anticorps primaire
-
anti-ER Lipid Raft Associated 1 (ERLIN1) antibody
ERLIN1 Reactivité: Humain, Souris, Rat IHC Hôte: Lapin Polyclonal unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) (AA 27-346) antibodyERLIN1 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) (AA 259-348) antibodyERLIN1 Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) (AA 244-273) antibodyERLIN1 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB33041 unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) antibodyERLIN1 Reactivité: Humain, Souris, Rat ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) (N-Term) antibodyERLIN1 Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Chévre WB Hôte: Lapin Polyclonal unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) (C-Term) antibodyVerified ERLIN1 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) (AA 74-123) antibodyERLIN1 Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien, Cobaye, Cheval, Lapin, Roussette (Chauve-souris), Porc WB Hôte: Lapin Polyclonal unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) antibodyERLIN1 Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Boeuf (Vache) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-ER Lipid Raft Associated 1 (ERLIN1) (AA 245-275), (Middle Region) antibodyERLIN1 Reactivité: Humain WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ERLIN1 Blocking Peptide, catalog no. 33R-4577, is also available for use as a blocking control in assays to test for specificity of this ERLIN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))
- Autre désignation
- ERLIN1 (ERLIN1 Produits)
- Synonymes
- anticorps C10orf69, anticorps Erlin-1, anticorps KE04, anticorps KEO4, anticorps SPFH1, anticorps wu:fa10h05, anticorps wu:fb19h05, anticorps zgc:110547, anticorps 2810439N09Rik, anticorps C80197, anticorps Keo4, anticorps Spfh1, anticorps RGD1307058, anticorps erlin-1, anticorps ER lipid raft associated 1, anticorps ERLIN1, anticorps erlin1, anticorps Erlin1
- Sujet
- Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.
- Poids moléculaire
- 39 kDa (MW of target protein)
-
