ICMT anticorps (Middle Region)

N° du produit ABIN635975

L’anticorps anti-ICMT Polyclonal Lapin est utilisé pour la détection de ICMT dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour ICMT anticorps (Middle Region) (ABIN635975)

Antigène: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ICMT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ICMT anticorps

Épitope: Middle Region

Specificité: ICMT antibody was raised against the middle region of ICMT

Purification: Affinity purified

Immunogène: ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ICMT Blocking Peptide, (ABIN938960), is also available for use as a blocking control in assays to test for specificity of this ICMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ICMT

Antigène: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Autre désignation: ICMT

Sujet: ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.

Poids moléculaire: 32 kDa (MW of target protein)