GOLM1 anticorps (N-Term)

N° du produit ABIN635986

Cet anticorps Lapin Polyclonal détecte spécifiquement GOLM1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour GOLM1 anticorps (N-Term) (ABIN635986)

Antigène: GOLM1 (Golgi Membrane Protein 1 (GOLM1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GOLM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GOLM1 anticorps

Épitope: N-Term

Specificité: GOLM1 antibody was raised against the N terminal of GOLM1

Purification: Affinity purified

Immunogène: GOLM1 antibody was raised using the N terminal of GOLM1 corresponding to a region with amino acids RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GOLM1 Blocking Peptide, (ABIN5613820), is also available for use as a blocking control in assays to test for specificity of this GOLM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GOLM1

Antigène: GOLM1 (Golgi Membrane Protein 1 (GOLM1))

Autre désignation: GOLM1

Sujet: GOLM1 is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Poids moléculaire: 45 kDa (MW of target protein)