UGT2B4 anticorps (N-Term)

N° du produit ABIN636004

Détail du produit anti-UGT2B4 anticorps

Antigène: UGT2B4 (UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT2B4 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGT2 B4 antibody was raised against the N terminal of µgT2 4

Purification: Affinity purified

Immunogène: UGT2 B4 antibody was raised using the N terminal of µgT2 4 corresponding to a region with amino acids NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT2B4 Blocking Peptide, catalog no. 33R-6722, is also available for use as a blocking control in assays to test for specificity of this µgT2B4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT2B4

Antigène: UGT2B4 (UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4))

Autre désignation: UGT2B4 (UGT2B4 Produits)

Synonymes: anticorps HLUG25, anticorps UDPGTH1, anticorps UGT2B11, anticorps UDPGT2B4, anticorps UGT2B17, anticorps UGT2B28, anticorps UDP glucuronosyltransferase family 2 member B4, anticorps UDP-glucuronosyltransferase 2B4, anticorps UGT2B4, anticorps LOC615303, anticorps LOC100066359

Sujet: UGT2B4 belongs to the UDP-glycosyltransferase family. UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis