HS3ST5 anticorps

N° du produit ABIN636027

Détail du produit anti-HS3ST5 anticorps

Antigène: HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HS3ST5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HS3 ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HS3ST5 Blocking Peptide, catalog no. 33R-8735, is also available for use as a blocking control in assays to test for specificity of this HS3ST5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HS3ST5

Antigène: HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))

Autre désignation: HS3ST5 (HS3ST5 Produits)

Synonymes: anticorps 3-OST-5, anticorps 3OST5, anticorps HS3OST5, anticorps NBLA04021, anticorps D930005L05Rik, anticorps Gm1151, anticorps Hs3ost5, anticorps HS3ST6, anticorps HS3ST5, anticorps heparan sulfate-glucosamine 3-sulfotransferase 5, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 5, anticorps HS3ST5, anticorps Hs3st5, anticorps hs3st5

Sujet: HS3ST5 is the rate limiting enzyme for synthesis of HSact. It performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site. HS3ST5 also generates GlcUA-GlcNS or IdoUA-GlcNS and IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process