B4GALNT3 anticorps (N-Term)

N° du produit ABIN636034

Cet anticorps Lapin Polyclonal détecte spécifiquement B4GALNT3 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour B4GALNT3 anticorps (N-Term) (ABIN636034)

Antigène: B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B4GALNT3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-B4GALNT3 anticorps

Épitope: N-Term

Specificité: B4 GALNT3 antibody was raised against the N terminal of B4 ALNT3

Purification: Affinity purified

Immunogène: B4 GALNT3 antibody was raised using the N terminal of B4 ALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B4GALNT3 Blocking Peptide, (ABIN5612262), is also available for use as a blocking control in assays to test for specificity of this B4GALNT3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B4GALNT3

Antigène: B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))

Autre désignation: B4GALNT3

Sujet: B4GALNT3 transfers N-acetylgalactosamine (GalNAc) onto glucosyl residues to form N,N-prime-diacetyllactosediamine (LacdiNAc, or LDN), a unique terminal structure of cell surface N-glycans. It mediates the N,N'-diacetyllactosediamine formation on gastric mucosa.

Poids moléculaire: 115 kDa (MW of target protein)