KDELR3 anticorps

N° du produit ABIN636049

Cet anticorps Lapin Polyclonal détecte spécifiquement KDELR3 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour KDELR3 anticorps (ABIN636049)

Antigène: KDELR3 (kDELR3) (KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 3 (kDELR3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KDELR3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KDELR3 anticorps

Purification: Affinity purified

Immunogène: KDELR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KDELR3 Blocking Peptide, (ABIN937021), is also available for use as a blocking control in assays to test for specificity of this KDELR3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KDELR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KDELR3

Antigène: KDELR3 (kDELR3) (KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 3 (kDELR3))

Autre désignation: KDELR3

Sujet: Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (kDaEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognises, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the kDaEL receptor gene family, have been described. kDaELR3 was the third member of the family to be identified, and it encodes a protein highly homologous to kDaELR1 and kDaELR2 proteins.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Maintenance of Protein Location