Layilin anticorps (N-Term)

N° du produit ABIN636057

Détail du produit anti-Layilin anticorps

Antigène: Layilin (LAYN)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Layilin est non-conjugé

Application: Western Blotting (WB)

Specificité: LAYN antibody was raised against the N terminal of LAYN

Purification: Affinity purified

Immunogène: LAYN antibody was raised using the N terminal of LAYN corresponding to a region with amino acids CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAYN Blocking Peptide, catalog no. 33R-1833, is also available for use as a blocking control in assays to test for specificity of this LAYN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAYN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Layilin

Antigène: Layilin (LAYN)

Autre désignation: LAYN (LAYN Produits)

Synonymes: anticorps LAYN, anticorps si:dkey-27p23.2, anticorps E030012M19Rik, anticorps Gm511, anticorps RGD1564444, anticorps layilin, anticorps layilin a, anticorps LAYN, anticorps layna, anticorps Layn

Sujet: LAYN contains 1 C-type lectin domain. It is the receptor for hyaluronate.

Poids moléculaire: 42 kDa (MW of target protein)