UGT1A9 anticorps (N-Term)

N° du produit ABIN636089

Détail du produit anti-UGT1A9 anticorps

Antigène: UGT1A9 (UDP Glucuronosyltransferase 1 Family, Polypeptide A9 (UGT1A9))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT1A9 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGT1 A9 antibody was raised against the N terminal of µgT1 9

Purification: Affinity purified

Immunogène: UGT1 A9 antibody was raised using the N terminal of µgT1 9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT1A9 Blocking Peptide, catalog no. 33R-5168, is also available for use as a blocking control in assays to test for specificity of this µgT1A9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT1A9

Antigène: UGT1A9 (UDP Glucuronosyltransferase 1 Family, Polypeptide A9 (UGT1A9))

Autre désignation: UGT1A9 (UGT1A9 Produits)

Synonymes: anticorps UGT1A9, anticorps DKFZP469N0814, anticorps SHEUGT1A07, anticorps HLUGP4, anticorps LUGP4, anticorps UDPGT, anticorps UDPGT 1-9, anticorps UGT-1I, anticorps UGT1-09, anticorps UGT1-9, anticorps UGT1.9, anticorps UGT1AI, anticorps UGT1I, anticorps UGTP4, anticorps Ugt1a12, anticorps mUGTBr/P, anticorps Ugt1a10, anticorps Ugt1a11, anticorps UDP glycosyltransferase 1 family, polypeptide A9, anticorps UDP glucuronosyltransferase 1 family, polypeptide A9, anticorps UDP glucuronosyltransferase family 1 member A9, anticorps UGT1A9, anticorps Ugt1a9

Sujet: UGT1A9 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. UGT1A9 is active on phenols.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha