IZUMO1 anticorps (C-Term)

N° du produit ABIN636096

Cet anticorps anti-IZUMO1 est un anticorps Lapin Polyclonal détectant IZUMO1 dans WB. Adapté pour Humain.

Aperçu rapide pour IZUMO1 anticorps (C-Term) (ABIN636096)

Antigène: IZUMO1 (Izumo Sperm-Egg Fusion 1 (IZUMO1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IZUMO1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IZUMO1 anticorps

Épitope: C-Term

Specificité: IZUMO1 antibody was raised against the C terminal of IZUMO1

Purification: Affinity purified

Immunogène: IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IZUMO1 Blocking Peptide, (ABIN5614233), is also available for use as a blocking control in assays to test for specificity of this IZUMO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IZUMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IZUMO1

Antigène: IZUMO1 (Izumo Sperm-Egg Fusion 1 (IZUMO1))

Autre désignation: IZUMO1

Sujet: The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.

Poids moléculaire: 39 kDa (MW of target protein)